HORDB

ID: hor006281
Uniprot ID: Q5XXR2
Protein name: Neuropeptide-glycine-glutamic acid
Gene name: PMCH
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
Family: Melanin-concentrating hormone family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0030354 melanin-concentrating hormone activity; GO:0031777 type 1 melanin-concentrating hormone receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007631 feeding behavior
GO CC: GO:0005576 extracellular region; GO:0005634 nucleus; GO:0045202 synapse

Sequence: GSVAFPAENGVQNTESTQE
Length: 19
Propeptide: MAKMSLSSYLLILTFSLFSQGILLSASKSIRNLEDDMVFNTFRLGKALQKEDTPQKSVVAPSLEQYKNDDSSFMNDEENKNSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
Signal peptide: MAKMSLSSYLLILTFSLFSQG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006281_AF2.pdb

hor006281_ESM.pdb

Mass:	228625	Formula:	C81H125N23O34
Absent amino acids:	CDHIKLMRWY	Common amino acids:	E
pI:	3.47	Basic residues:	0
Polar residues:	8	Hydrophobic residues:	5
Hydrophobicity:	-79.47	Boman Index:	-4017
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	41.05
Instability Index:	4381.05	Extinction Coefficient cystines:	0
Absorbance 280nm:	0